PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006405m
Common NameCARUB_v10006405mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 136aa    MW: 15879 Da    PI: 10.6656
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006405mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.7e-152063448
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     WT  Ed +l ++v+  G+  W+ I + m+ gRt+k c+srw++yl
  Carubv10006405m 20 WTSLEDSKLRELVAVSGPQKWSHIGKQMQ-GRTGKTCRSRWFNYL 63
                     *****************************.**************7 PP

2Myb_DNA-binding39.81e-1269110144
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++++ eE e+l++a+k+lG++ W++Ia+++  gRt+  +   +
  Carubv10006405m  69 KDAFSDEENEKLLKAHKELGNK-WSRIAKRFH-GRTDRAVHKQF 110
                      679*******************.*********.****9886655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.6651267IPR017930Myb domain
SuperFamilySSF466894.21E-2515108IPR009057Homeodomain-like
SMARTSM007171.9E-101665IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-241970IPR009057Homeodomain-like
PfamPF002491.2E-132063IPR001005SANT/Myb domain
CDDcd001674.97E-92063No hitNo description
PROSITE profilePS5129413.04268118IPR017930Myb domain
SMARTSM007173.2E-1168116IPR001005SANT/Myb domain
PfamPF002491.5E-1069110IPR001005SANT/Myb domain
CDDcd001671.23E-671114No hitNo description
Gene3DG3DSA:1.10.10.601.3E-1971119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
RPLNEVREEE KNKDRQSKLW TSLEDSKLRE LVAVSGPQKW SHIGKQMQGR TGKTCRSRWF  60
NYLDPKINKD AFSDEENEKL LKAHKELGNK WSRIAKRFHG RTDRAVHKQF DKLMRRELKK  120
PSSASPHDPN DKAEG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-28201187105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006282491.13e-96hypothetical protein CARUB_v10006405mg, partial
TrEMBLR0GF624e-96R0GF62_9BRAS; Uncharacterized protein (Fragment)
STRINGfgenesh1_pg.C_scaffold_70031695e-45(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1909957
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G29020.14e-43myb domain protein 110